.
The Open Protein Structure Annotation Network
PDB Keyword
.

2joe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of E. Coli YehR Protein. To be Published
    Site NESGC
    PDB Id 2joe Target Id ER538
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8853,PF06998, 3.30.1830.10, 15167 Molecular Weight 14297.58 Da.
    Residues 131 Isoelectric Point 5.61
    Sequence mgdkeeskkfsanlngteiaityvykgdkvlkqssetkiqfasigattkedaaktleplsakykniagv eekltytdtyaqenvtidmekvdfkalqgisginvsaedakkgitmaqmelvmkaagfkevk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2joe
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch