.
The Open Protein Structure Annotation Network
PDB Keyword
.

2joq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Protein HP0495 from H. pylori. To be Published
    Site NESGC
    PDB Id 2joq Target Id PT2
    Molecular Characteristics
    Source Helicobacter pylori
    Alias Ids TPS8999,15101, PF04359 Molecular Weight 10192.20 Da.
    Residues 86 Isoelectric Point 8.71
    Sequence mpsdskkptiiypclwdyrvimttkdtstlkelletyqrpfklefkntsknakfysfnvsmevsneser neifqkisqldkvvqtl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2joq
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    2. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch