.
The Open Protein Structure Annotation Network
PDB Keyword
.

2joy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of 50S Ribosomal Protein L14e; Northeast Structural Genomics Consortium Target SSR105. To be Published
    Site NESGC
    PDB Id 2joy Target Id SsR105
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS9163,15210, 2.30.30.30, BIG_711, PF01929 Molecular Weight 10860.28 Da.
    Residues 96 Isoelectric Point 9.14
    Sequence mpaievgricvkvkgreagskcvivdiiddnfvlvtgpkditgvkrrrvnilhleptdkkidiqkgasd eevkkkleesnlteymkekikirmptl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2joy
    1. The crystal structure of Mtr4 reveals a novel arch domain required for rRNA processing
    RN Jackson, AA Klauer, BJ Hintze, H Robinson - The EMBO , 2010 - nature.com
     
    2. Structure, Stability, and Flexibility of Ribosomal Protein L14e from Sulfolobus solfataricus
    SP Edmondson, J Turri, K Smith, A Clark - Biochemistry, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch