.
The Open Protein Structure Annotation Network
PDB Keyword
.

2joz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of protein yxeF , Northeast Structural Genomics Consortium target Sr500a. To be Published
    Site NESGC
    PDB Id 2joz Target Id SR500A
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9105,PF11631, 2.40.128.20, 15211 Molecular Weight 14356.37 Da.
    Residues 127 Isoelectric Point 4.88
    Sequence mimvsgcqqqkeetpfyygtwdegrapgptdgvksatvtftedevvetevmegrgevqlpfmaykvisq stdgsieiqylgpyyplkstlkrgengtliweqngqrktmtriesktgreekdeksks
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2joz
    1. NMR Structure of Lipoprotein YxeF from Bacillus subtilis Reveals a Calycin Fold and Distant Homology with the Lipocalin Blc from Escherichia coli
    Y Wu, M Punta, R Xiao, TB Acton, B Sathyamoorthy - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch