.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jpq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Vibrio parahaemolyticus VP2129. Northeast Structural Genomics. To be Published
    Site NESGC
    PDB Id 2jpq Target Id VpR61
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS9243,1.10.3390.10, 15258, PF07208 Molecular Weight 8203.11 Da.
    Residues 75 Isoelectric Point 6.72
    Sequence mpitskytdeqvekilaevalvlekhaaspeltlmiagniatnvlnqrvaasqrkliaekfaqalmssl etpkth
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jpq
    1. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch