.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jpu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of NESG target SsR10, Orf c02003 protein. To be Published
    Site NESGC
    PDB Id 2jpu Target Id SsR10
    Related PDB Ids 2q00 
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS9162,15265, PF05942, 1.20.1270.90, 1.20.120.330 Molecular Weight 13991.34 Da.
    Residues 121 Isoelectric Point 6.75
    Sequence msistsaevyyeeaeeflskgdlvqacekyykaaeeaikllviennlkeitnnvknkgrwksenlfkas kllrsnnteipilwksawtlhvegfhelslnekevkklkedvrklvifavns
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jpu
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch