.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jq5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a Se-C motif containing protein from Rhodopseudomonas palustris. To be Published
    Site NESGC
    PDB Id 2jq5 Target Id RpT5
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS9055,BIG_389, PF02810, 3.10.450.50, 15270 Molecular Weight 14637.44 Da.
    Residues 128 Isoelectric Point 5.95
    Sequence mncvcgsgktyddccgpllartrsaaspealmrsryaayalkdfdyivettdperrdlfdhdvnrawme esdflelrvlgssekgsrgtvefiarfrrgggpeqshhersqfrkargrwyfsegeavd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2jq5
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch