.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jqo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structure of Bacillus subtilis YobA 21-120: Northeast Structural Genomics Consortium target SR547. To be Published
    Site NESGC
    PDB Id 2jqo Target Id SR547
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9107,2.40.50.140, 15288, PF11518 Molecular Weight 11440.41 Da.
    Residues 100 Isoelectric Point 5.83
    Sequence mnkneqngdetkmqslvgyvvlkdnerailitdtkapgkedynlsegqlmnkfknnivivglseidntd dlkrgekikvwfhtrkesnppsatiqkyell
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch