The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of homodimer CPS_2611 from Colwellia psychrerythraea. To be Published
    Site NESGC
    PDB Id 2jr2 Target Id CsR4
    Related PDB Ids 2ota 
    Molecular Characteristics
    Source Colwellia psychrerythraea
    Alias Ids TPS8802,1.10.3390.10, PF07208, 15317 Molecular Weight 7525.45 Da.
    Residues 68 Isoelectric Point 5.21
    Sequence mpivskysnervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnftkalkqsv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information


    Google Scholar output for 2jr2
    1. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch