.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jr5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of UPF0350 protein VC_2471. To be Published
    Site NESGC
    PDB Id 2jr5 Target Id VcR36
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS31725,PF03937, 1.10.150.250, 15320 Molecular Weight 9853.81 Da.
    Residues 86 Isoelectric Point 4.61
    Sequence mytaeqkarikwacrrgmleldvvimpffeecfdslteseqddfvallesddpdlfawvmghgrcenlg laamvdkivahnlskvr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jr5
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch