.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jr6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of UPF0434 protein NMA0874. To be Published
    Site NESGC
    PDB Id 2jr6 Target Id MR32
    Molecular Characteristics
    Source Neisseria meningitidis
    Alias Ids TPS8960,PF03966, 2.20.25.10, 15321 Molecular Weight 7064.83 Da.
    Residues 60 Isoelectric Point 5.76
    Sequence mekkfldilvcpvtkgrleyhqdkqelwsrqaklaypikdgipymlenearalseeelka
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch