.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jra

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A novel domain-swapped solution NMR structure of protein RPA2121 from Rhodopseudomonas palustris. To be Published
    Site NESGC
    PDB Id 2jra Target Id RpT6
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS9056,PF10636, 2.10.70.10, 15324 Molecular Weight 7284.82 Da.
    Residues 67 Isoelectric Point 8.27
    Sequence mmtasdrlgadptqaasspggaravsivgnqidsrelftvdreiviahgddryrlrltsqnkliltk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jra
    1. A new small regulatory protein, HmuP, modulates haemin acquisition in Sinorhizobium meliloti
    V Amarelle, U Koziol, F Rosconi, F Noya - , 2010 - Soc General Microbiol
     
    2. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch