.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jrf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Tubulin polymerization-promoting protein family member 3 from Homo sapiens. To be Published
    Site NESGC
    PDB Id 2jrf Target Id HR387
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS31720,PF05517, 15329, 1.10.238.10 Molecular Weight 18984.44 Da.
    Residues 176 Isoelectric Point 9.19
    Sequence maastdmagleesfrkfaihgdpkasgqemngknwaklckdckvadgksvtgtdvdivfskvkgksarv inyeefkkaleelatkrfkgkskeeafdaicqlvagkepanvgvtkaktggavdrltdtsrytgshker fdesgkgkgiagrqdilddsgyvsayknagtydakvkk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jrf
    1. An unstructured protein with destructive potential: TPPP/p25 in neurodegeneration
    J Ovdi, F Orosz - Bioessays, 2009 - Wiley Online Library
     
    2. Identification of multiple post_translational modifications in the porcine brain specific p25_
    AJ Kleinnijenhuis, C Hedegaard - Journal of , 2008 - Wiley Online Library
     
    3. The tubulin polymerization promoting protein, TPPP/p25
    J Ovdi - IUBMB life, 2008 - Wiley Online Library
     
    4. Disordered TPPP/p25 binds GTP and displays Mg2+-dependent GTPase activity
    Zotter, A Bodor, J Olh, E Hlavanda, F Orosz - FEBS letters, 2011 - Elsevier
     
    5. TPPP/p25: A New Unstructured Protein Hallmarking Synucleinopathies
    F Orosz, A Lehotzky, J Olh, J Ovdi - Protein Folding and Misfolding: , 2009 - Springer
     
    6. Zn2+-Induced Rearrangement of the Disordered TPPP/p25 Affects Its Microtubule Assembly and GTPase Activity
    A Zotter, J Ola_h, E Hlavanda, A Bodor, A Perczel - Biochemistry, 2011 - ACS Publications
     
    7. Multiple Roles of Heparin in the Aggregation of p25_
    SB Nielsen, P Yde, L Giehm, S Sundbye - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch