.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jrj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecular basis of Pirh2-mediated p53 ubiquitylation. Nat.Struct.Mol.Biol. 15 1334-1342 2008
    Site NESGC
    PDB Id 2jrj Target Id HT2B
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8928,3.30.40.10, PF00097, 15333 Molecular Weight 5935.63 Da.
    Residues 51 Isoelectric Point 6.56
    Sequence envsrqncpicledihtsrvvahvlpcghllhrtcyeemlkegyrcplcmh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2jrj
    1. Molecular basis of Pirh2-mediated p53 ubiquitylation
    Y Sheng, RC Laister, A Lemak, B Wu, E Tai - Nature structural & , 2008 - nature.com
     
    2. RING finger E3 ubiquitin ligases: structure and drug discovery
    CT Chasapis, GA Spyroulias - Current pharmaceutical design, 2009 - ingentaconnect.com
     
    3. Bi-directional SIFT predicts a subset of activating mutations
    W Lee, Y Zhang, K Mukhyala, RA Lazarus, Z Zhang - PloS one, 2009 - dx.plos.org
     
    4. NMR_based insights into the conformational & interaction properties of Arkadia RING_H2 E3 Ub ligase
    CT Chasapis, NG Kandias, V Episkopou - Proteins: Structure, , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch