.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jrm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Ribosome Modulation Factor VP1593 from Vibrio parahaemolyticus. To be Published
    Site NESGC
    PDB Id 2jrm Target Id VpR55
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS9242,PF04957, 15339, 1.10.10.620 Molecular Weight 6721.16 Da.
    Residues 57 Isoelectric Point 9.91
    Sequence mkrqkrdrleraqsqgykaglngrsqeacpyqqvdarsywlggwrdardekqsglyk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch