The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of YfgJ from Salmonella typhimurium Modeled with Two Zn+2 Bound. To be Published
    Site NESGC
    PDB Id 2jrp Target Id StR86
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9178,15338, PF07191, Molecular Weight 8078.85 Da.
    Residues 73 Isoelectric Point 6.37
    Sequence meitcpvchhalerngdtahcetcakdfslqalcpdcrqplqvlkacgavdyfcqnghgliskkrvnfv isdq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch