.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jrr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Q5LLS5 from Silicibacter pomeroyi. To be Published
    Site NESGC
    PDB Id 2jrr Target Id SiR90
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS9140,15341, 2.60.260.40, BIG_661, PF10276 Molecular Weight 6437.02 Da.
    Residues 59 Isoelectric Point 5.12
    Sequence mtiqapetkivdksrvacdggegalghprvwlqipedtgwvecpycdckyvlkgskada
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jrr
    1. Evolution of Respiratory Complex I SUPERNUMERARY SUBUNITS ARE PRESENT IN THE _-PROTEOBACTERIAL ENZYME
    C Yip, ME Harbour, K Jayawardena, IM Fearnley - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch