The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of CAPER RRM2 Domain. To be Published
    Site NESGC
    PDB Id 2jrs Target Id HR4730A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8922,15343, PF00076, Molecular Weight 10674.62 Da.
    Residues 97 Isoelectric Point 6.14
    Sequence aaamannlqkgsagpmrlyvgslhfnitedmlrgifepfgriesiqlmmdsetgrskgygfitfsdsec akkaleqlngfelagrpmkvghvtertd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch