.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jrx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Chemical Shift Assignments of E. coli YejL protein. To be Published
    Site NESGC
    PDB Id 2jrx Target Id ER309
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8842,1.10.3390.10, PF07208, 15346 Molecular Weight 8288.00 Da.
    Residues 75 Isoelectric Point 5.50
    Sequence mpqisrysdeqveqllaellnvlekhkaptdlslmvlgnmvtnlintsiapaqrqaiansfaralqssi nedkah
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jrx
    1. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch