.
The Open Protein Structure Annotation Network
PDB Keyword
.

2js1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of the Bacillus subtilis Protein YvfG. To be Published
    Site NESGC
    PDB Id 2js1 Target Id SR478
    Related PDB Ids 2gsv 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9103,PF09628, 15350 Molecular Weight 8471.28 Da.
    Residues 72 Isoelectric Point 8.02
    Sequence mselfsvpyfienlkqhiemnqsedkihamnsyyrsvvstlvqdqltknavvlkriqhldeaynkvkrg esk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2js1
    1. Binuclear non-heme iron enzymes
    N Miti_, G Schenk, GR Hanson - High Resolution EPR, 2009 - Springer
     
    2. Temperature dependence of relaxation time of a stable radical pair in SyPixD investigated by pulsed EPR
    T Kondo, S Masuda, K Tsutsui, H Mino - Chemical Physics Letters, 2011 - Elsevier
     
    3. PACSY, a relational database management system for protein structure and chemical shift analysis
    W Lee, W Yu, S Kim, I Chang, W Lee - Journal of Biomolecular , 2012 - Springer
     
    4. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     
    5. Biomimetic and Theoretic Investigations of Unusual IronSulphur Clusters
    MGG Fuchs - 2009 - deposit.ddb.de
     
    6. Spectroscopic studies of intermediates in metalloenzymes and biomimetic complexes
    WA Gunderson - 2009 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch