.
The Open Protein Structure Annotation Network
PDB Keyword
.

2js3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of protein Q6N9A4_RHOPA. To be Published
    Site NESGC
    PDB Id 2js3 Target Id RpT8
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS9058,1.10.287.780, PF11519, 15352 Molecular Weight 8008.72 Da.
    Residues 75 Isoelectric Point 5.44
    Sequence mtdtaaedvrkiatallktaieivseedggahnqcklcgasvpwlqtgdeikhaddcpvviakqilssr pklhav
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2js3
    1. Phosphorylation facilitates the integrin binding of filamin under force
    HS Chen, KS Kolahi, MRK Mofrad - Biophysical journal, 2009 - Elsevier
     
    2. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     
    3. Spectroscopic studies of intermediates in metalloenzymes and biomimetic complexes
    WA Gunderson - 2009 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch