.
The Open Protein Structure Annotation Network
PDB Keyword
.

2js4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of Bordetella bronchiseptica protein BB2007. To be Published
    Site NESGC
    PDB Id 2js4 Target Id BoR54
    Molecular Characteristics
    Source Bordetella bronchiseptica
    Alias Ids TPS8772,PF03966, 2.20.25.10, 15353 Molecular Weight 6810.49 Da.
    Residues 62 Isoelectric Point 4.69
    Sequence mesrlldilvcpvckgrlefqraqaelvcnadrlafpvrdgvpimleaearsldaeapaqps
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch