.
The Open Protein Structure Annotation Network
PDB Keyword
.

2js5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of protein Q60C73_METCA. To be Published
    Site NESGC
    PDB Id 2js5 Target Id McR1
    Molecular Characteristics
    Source Methylococcus capsulatus str. bath
    Alias Ids TPS8972,PF05082, 1.10.287.660, 15354 Molecular Weight 7185.77 Da.
    Residues 63 Isoelectric Point 5.31
    Sequence msegaeelkaklkklnaqatalkmdlhdlaedlptgwnrimevaektyeayrqldefrkstas
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2js5
    1. Structural characterization of the protein cce_0567 from Cyanothece 51142, a metalloprotein associated with nitrogen fixation in the DUF683 family
    GW Buchko, H Robinson, A Addlagatta - Biochimica et Biophysica Acta ( , 2009 - Elsevier
     
    2. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch