.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jt1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of PefI (Plasmid-Encoded Fimbriae Regulatory) protein from Salmonella typhimurium. Northeast Structural Genomics target StR82. To be Published
    Site NESGC
    PDB Id 2jt1 Target Id StR82
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9177,15386, PF04703, 1.10.10.10 Molecular Weight 7719.54 Da.
    Residues 70 Isoelectric Point 5.65
    Sequence msesivtkiisivqerqnmddgapvktrdiadaaglsiyqvrlyleqlhdvgvlekvnagkgvpglwrll
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jt1
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     
    2. A microscale protein NMR sample screening pipeline
    P Rossi, GVT Swapna, YJ Huang, JM Aramini - Journal of biomolecular , 2010 - Springer
     
    3. Structural analysis reveals DNA binding properties of Rv2827c, a hypothetical protein from Mycobacterium tuberculosis
    R Janowski, S Panjikar, AN Eddine - Journal of structural and , 2009 - Springer
     
    4. Combining NMR ensembles and molecular dynamics simulations provides more realistic models of protein structures in solution and leads to better chemical shift
    J Lehtivarjo, K Tuppurainen, T Hassinen - Journal of Biomolecular , 2012 - Springer
     
    5. Solution NMR structure of the plasmid_encoded fimbriae regulatory protein PefI from Salmonella enterica serovar Typhimurium
    JM Aramini, P Rossi, JR Cort, LC Ma - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch