.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jtv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of protein RPA3401, Northeast Structural Genomics Consortium Target RpT7, Ontario Center for Structural Proteomics Target RP3384. TO BE PUBLISHED
    Site NESGC
    PDB Id 2jtv Target Id RpT7
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS9057,15419, 1.10.10.10 Molecular Weight 7365.82 Da.
    Residues 65 Isoelectric Point 9.51
    Sequence mataddfklirdihstggrrqvfgsreqkpfedlvdlgwlkrssvdsrathyqitergtsaalrs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jtv
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch