The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of PARC CPH Domain. To be Published
    Site NESGC
    PDB Id 2juf Target Id HR3443B
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8916,, PF11515, 15509, Molecular Weight 37924.81 Da.
    Residues 343 Isoelectric Point 5.41
    Sequence esgtpsltaavlhtihvlsayasigpltgvfretgaldllmhmlcnpepqirrsagkmlqalaahdags rahvllslsqqdgieqhmdfdsrytllelfaettsseehcmafegihlpqipgkllfslvkrylcvtsl ldqlnsspelgagdqsspcatreksrgqrelefsmavgnliselvrsmgwarnlseqgmspprptrsif qpyisgpslllptivttprrqgwvfrqrsefssrsgygeyvqqtlqpgmrvrmlddyeeisagdegefr qsnngippvqvfwqstgrtywvhwhmleilgpeeatedkasaavekgagatvlgtafpswdwnpmdg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2juf
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch