.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jva

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of Peptidyl-tRNA hydrolase domain protein from Pseudomonas syringae pv. tomato. To be Published
    Site NESGC
    PDB Id 2jva Target Id PsR211
    Molecular Characteristics
    Source Pseudomonas syringae
    Alias Ids TPS20388,BIG_675, 15471, PF00472, 3.30.160.200 Molecular Weight 15206.67 Da.
    Residues 137 Isoelectric Point 10.61
    Sequence mlvisnnvhlpdaeieltairaqgaggqnvnkvssamhlrfdinasslppfykerllalndsritsdgv ivlkaqqyrtqeqnradallrlselivnaakvekkrrptrptlgsktrrleskskrgsikagrgkvdf
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jva
    1. NMR structure of the peptidyl_tRNA hydrolase domain from Pseudomonas syringae expands the structural coverage of the hydrolysis domains of class 1 peptide
    KK Singarapu, R Xiao, T Acton, B Rost - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch