.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jvd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the SOS response protein YnzC from Bacillus subtilis. Proteins 72 526-530 2008
    Site NESGC
    PDB Id 2jvd Target Id SR384
    Related PDB Ids 3bhp 2hep 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9089,1.10.287.540, PF05979, 15476, 7225 Molecular Weight 8805.72 Da.
    Residues 77 Isoelectric Point 9.79
    Sequence misnakiarinelaakakagviteeekaeqqklrqeylkgfrssmkntlksvkiidpegndvtpeklkr eqrnnklh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jvd
    1. Quantum chemical 13C_ chemical shift calculations for protein NMR structure determination, refinement, and validation
    JA Vila, JM Aramini, P Rossi, A Kuzin - Proceedings of the , 2008 - National Acad Sciences
     
    2. Construct optimization for protein NMR structure analysis using amide hydrogen/deuterium exchange mass spectrometry
    S Sharma, H Zheng, YJ Huang - Proteins: Structure, , 2009 - Wiley Online Library
     
    3. Assessing the accuracy of protein structures by quantum mechanical computations of 13C_ chemical shifts
    JA Vila, HA Scheraga - Accounts of chemical research, 2009 - ACS Publications
     
    4. A mathematical framework for protein structure comparison
    W Liu, A Srivastava, J Zhang - PLoS computational biology, 2011 - dx.plos.org
     
    5. Solution NMR structure of the SOS response protein YnzC from Bacillus subtilis
    JM Aramini, S Sharma, YJ Huang - Proteins: Structure, , 2008 - Wiley Online Library
     
    6. Protein structure alignment using elastic shape analysis
    W Liu, A Srivastava, J Zhang - Proceedings of the First ACM International , 2010 - dl.acm.org
     
    7. Sequential nearest-neighbor effects on computed 13 C _ chemical shifts
    JA Vila, P Serrano, K Wthrich - Journal of biomolecular , 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch