The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Rhodobacter sphaeroides protein RHOS4_26430. To be Published
    Site NESGC
    PDB Id 2jvm Target Id RhR95
    Molecular Characteristics
    Source Rhodobacter sphaeroides
    Alias Ids TPS9046,, BIG_661, PF10276, 15482 Molecular Weight 8090.78 Da.
    Residues 72 Isoelectric Point 7.77
    Sequence mrrqpktrqesarmsieapetvvvstwkvacdggegalghprvwlsiphetgfvecgycdrryihesfa aak
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2jvm
    C Yip, ME Harbour, K Jayawardena, IM Fearnley - Journal of Biological , 2011 - ASBMB

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch