.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jvw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of uncharacterized protein Q5E7H1 from Vibrio fischeri. To be Published
    Site NESGC
    PDB Id 2jvw Target Id VfR117
    Molecular Characteristics
    Source Vibrio fischeri
    Alias Ids TPS9234,1.10.720.30, 15491, BIG_724, PF09905 Molecular Weight 9658.78 Da.
    Residues 80 Isoelectric Point 9.42
    Sequence malimtqqnnplhgitlqklltelvehygweelsymvnincfkkdpsiksslkflrktdwarerveniy lklqrhkernq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jvw
    1. Solution NMR structure of VF0530 from Vibrio fischeri reveals a nucleic acid_binding function
    JM Aramini, P Rossi, M Fischer, R Xiao - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch