The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of uncharacterized lipoprotein yajI from Escherichia coli. To be Published
    Site NESGC
    PDB Id 2jwy Target Id ER540
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8854,PF11622, 15542, Molecular Weight 17508.96 Da.
    Residues 160 Isoelectric Point 5.04
    Sequence mvqqsevrqmkhsvstlnqemtqlnqetvkitqqnrlnaksssgvyllpgaktparlesqigtlrmslv nitpdadgttltlriqgesndplpafsgtveygqiqgtidnfqeinvqnqlinapasvlapsdvdiplq lkgisvdqlgfvrihdiqpvmq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch