.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jxp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of uncharacterized lipoprotein B from Nitrosomonas europaea. To be Published
    Site NESGC
    PDB Id 2jxp Target Id NeR45A
    Molecular Characteristics
    Source Nitrosomonas europaea
    Alias Ids TPS8982,PF04390, 3.30.160.150, 15568 Molecular Weight 16470.14 Da.
    Residues 147 Isoelectric Point 8.03
    Sequence mgfklrgqvselpfervyitapagltigsdlervisthtrakvvnkaekseaiiqivhairekrilsls esgrvrefelvyrvaarlldahnaelaslqeirltrilpfldaqelakaaeeemlykdmqkdavqqilr qvsavtsag
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jxp
    1. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel
    E Freinkman, SS Chng - Proceedings of the , 2011 - National Acad Sciences
     
    2. Protein epitope mimetics as anti-infectives
    JA Robinson - Current Opinion in Chemical Biology, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch