.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jxt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of 50S ribosomal protein LX from Methanobacterium thermoautotrophicum. To be Published
    Site NESGC
    PDB Id 2jxt Target Id TR80
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9190,BIG_727, 3.10.20.10, 15573, PF01775 Molecular Weight 9279.44 Da.
    Residues 78 Isoelectric Point 9.26
    Sequence mkmktkifrvkgkflmgdklqpftkelnaireeeiyerlysefgskhrvprskvkieeieeispeevqd pvvkalvqr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jxt
    1. Using NMR chemical shifts as structural restraints in molecular dynamics simulations of proteins
    P Robustelli, K Kohlhoff, A Cavalli, M Vendruscolo - Structure, 2010 - Elsevier
     
    2. Cryo-EM Structure of the Archaeal 50S Ribosomal Subunit in Complex with Initiation Factor 6 and Implications for Ribosome Evolution
    BJ Greber, D Boehringer, V Godinic-Mikulcic - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch