.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jxx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Ubiquitin-like domain of NFATC2IP. TO BE PUBLISHED
    Site NESGC
    PDB Id 2jxx Target Id HR5627
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8924,3.10.20.90, 15576, PF11976 Molecular Weight 15053.36 Da.
    Residues 138 Isoelectric Point 5.00
    Sequence mseplqsvvdhmathlgvspsrilllfgetelsptatprtlklgvadiidcvvltsspeatetsqqlql rvqgkekhqtlevslsrdsplktlmshyeeamglsgrklsfffdgtklsgrelpadlgmesgdlievwg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jxx
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     
    2. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch