The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A novel solution NMR structure of protein yst0336 from Saccharomyces cerevisiae. To be Published
    Site NESGC
    PDB Id 2jyn Target Id YT51
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS9261,PF04669, 15595, 1.10.3560.10 Molecular Weight 17443.89 Da.
    Residues 146 Isoelectric Point 5.24
    Sequence mstfnaetadnlediekqfavvaveqaetywklltsvpgsklrltkfddeiyenfmerfpeykdvervk kfteeelktkeakerwrkfftifekkiedynfgtllrtdasaeygqfttcfvvrlqfyafeiarnkhgl ndwivgqk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2jyn
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch