.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jz2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Ssl0352 protein from Synechocystis sp. To be Published
    Site NESGC
    PDB Id 2jz2 Target Id SgR42
    Related PDB Ids 3c4s 
    Molecular Characteristics
    Source Synechocystis sp. pcc 6803
    Alias Ids TPS9136,PF11623, 15604, BIG_1284 Molecular Weight 6577.19 Da.
    Residues 58 Isoelectric Point 5.13
    Sequence mifpgatvrvtnvddtyyrfeglvqrvsdgkaavlfengnwdklvtfrlseleavkpi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch