.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jz5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structures of proteins VPA0419 from Vibrio parahaemolyticus and yiiS from Shigella flexneri provide structural coverage for protein domain family PFAM 04175. Proteins 78 779-784 2010
    Site NESGC
    PDB Id 2jz5 Target Id VpR68
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS9244,PF04175, 3.30.70.860, 15608 Molecular Weight 10917.75 Da.
    Residues 99 Isoelectric Point 4.41
    Sequence msveleesqvceacgcageigfiikegdevadvtifaetkdaleselakyielaksvcagveynvselt eeskeltarfkfevsaeklifelktrslar
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jz5
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     
    2. A microscale protein NMR sample screening pipeline
    P Rossi, GVT Swapna, YJ Huang, JM Aramini - Journal of biomolecular , 2010 - Springer
     
    3. Solution NMR structures of proteins VPA0419 from Vibrio parahaemolyticus and yiiS from Shigella flexneri provide structural coverage for protein domain family PFAM
    KK Singarapu, JL Mills, R Xiao, T Acton - Proteins: Structure, , 2010 - Wiley Online Library
     
    4. Order and disorder in proteins
    A Ertekin - 2011 - mss3.libraries.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch