.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jz6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of 50S ribosomal protein L28 from Thermotoga maritima. Northeast Structural Genomics Consortium target VR97. To be Published
    Site NESGC
    PDB Id 2jz6 Target Id VR97
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS9222,4.10.1160.10, 2.30.170.40, 15609, PF00830 Molecular Weight 8051.21 Da.
    Residues 72 Isoelectric Point 10.42
    Sequence mimakrcevcgkaprsgntvshsdkksgrwfrpnlqkvrvvlpdgtikrmrvctsclksgkvkkyvgqv sev
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jz6
    1. Automatic structure classification of small proteins using random forest
    P Jain, J Hirst - BMC bioinformatics, 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch