.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jz8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of BH09830 from Bartonella henselae modeled with one Zn+2 bound. To be Published
    Site NESGC
    PDB Id 2jz8 Target Id BnR55
    Molecular Characteristics
    Source Bartonella henselae (houston-1)
    Alias Ids TPS8767,2.60.260.40, BIG_661, PF10276, 15610 Molecular Weight 9071.81 Da.
    Residues 79 Isoelectric Point 5.00
    Sequence madyniphfqndlgykiieigvkefmcvgatqpfdhphifidmgstdekicpycstlyrydpslsynqt nptgclynpk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2jz8
    1. Evolution of Respiratory Complex I SUPERNUMERARY SUBUNITS ARE PRESENT IN THE _-PROTEOBACTERIAL ENZYME
    C Yip, ME Harbour, K Jayawardena, IM Fearnley - Journal of Biological , 2011 - ASBMB
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch