.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jzc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Alg13: the sugar donor subunit of a yeast N-acetylglucosamine transferase. Structure 16 965-975 2008
    Site NESGC
    PDB Id 2jzc Target Id YG1
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS9259,3.40.50.2000, 15617, PF04101 Molecular Weight 22659.86 Da.
    Residues 202 Isoelectric Point 5.58
    Sequence mgiieekalfvtcgatvpfpklvscvlsdefcqeliqygfvrliiqfgrnyssefehlvqerggqresq kipidqfgcgdtarqyvlmngklkvigfdfstkmqsiirdysdlvishagtgsildslrlnkplivcvn dslmdnhqqqiadkfvelgyvwscaptetgliaglrasqteklkpfpvshnpsferllvetiys
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jzc
    1. NMR structure determination for larger proteins using backbone-only data
    S Raman, OF Lange, P Rossi, M Tyka, X Wang - Science, 2010 - sciencemag.org
     
    2. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    3. Solution structure of Alg13: The sugar donor subunit of a yeast N-acetylglucosamine transferase
    X Wang, T Weldeghiorghis, G Zhang, B Imperiali - Structure, 2008 - Elsevier
     
    4. Interaction between the C termini of Alg13 and Alg14 mediates formation of the active UDP-N-acetylglucosamine transferase complex
    XD Gao, S Moriyama, N Miura, N Dean - Journal of Biological , 2008 - ASBMB
     
    5. Functional and Structural Analysis Reveals Dual Function on C-Terminal _ Helix of Alg13 Protein
    XD Gao, S Moriyama, N Miura, SI Nishimura - Molecular Imaging for , 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch