.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jzt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Protein chaperones Q8ZP25_SALTY from Salmonella typhimurium and HYAE_ECOLI from Escherichia coli exhibit thioredoxin-like structures despite lack of canonical thioredoxin active site sequence motif. J.STRUCT.FUNCT.GENOM. 9 41-49 2008
    Site NESGC
    PDB Id 2jzt Target Id StR70
    Related PDB Ids 2es7 2gzp 
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9175,7178, PF07449, 3.40.30.10 Molecular Weight 15060.29 Da.
    Residues 134 Isoelectric Point 4.69
    Sequence mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefpqfd wqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivdtpaaqetvq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jzt
    1. Protein chaperones Q8ZP25_SALTY from Salmonella typhimurium and HYAE_ECOLI from Escherichia coli exhibit thioredoxin-like structures despite lack of canonical
    D Parish, J Benach, G Liu, KK Singarapu - Journal of structural and , 2008 - Springer
     
    2. Development and application of methodology for rapid NMR data collection and protein structure determination
    DM Parish - 2008 - books.google.com
     
    3. How Accurately Can We Model Protein Structures with Dihedral Angles?
    X Cui, S Li, D Bu, B Alipanahi Ramandi, M Li - Algorithms in Bioinformatics, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch