.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k07

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR and X-RAY structures of human E2-like ubiquitin-fold modifier conjugating enzyme 1 (UFC1) reveal structural and functional conservation in the metazoan UFM1-UBA5-UFC1 ubiquination pathway. J.STRUCT.FUNCT.GENOM. 10 127-136 2009
    Site NESGC
    PDB Id 2k07 Target Id HR41
    Related PDB Ids 3evx 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8919,PF08694, 6546 Molecular Weight 19457.41 Da.
    Residues 167 Isoelectric Point 6.91
    Sequence madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkegtrwfgkc wyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfkplwarnvpkfglahlm alglgpwlaveipdliqkgviqhkekcnq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k07
    1. NMR and X-RAY structures of human E2-like ubiquitin-fold modifier conjugating enzyme 1 (UFC1) reveal structural and functional conservation in the metazoan UFM1
    G Liu, F Forouhar, A Eletsky, HS Atreya - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch