.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k0m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the uncharacterized protein from Rhodospirillum rubrum gene locus Rru_A0810. Northeast Structural Genomics Target RrR43. To be Published
    Site NESGC
    PDB Id 2k0m Target Id RrR43
    Molecular Characteristics
    Source Rhodospirillum rubrum
    Alias Ids TPS9059,15652, BIG_1025, 3.10.450.40, PF11523 Molecular Weight 10781.82 Da.
    Residues 96 Isoelectric Point 9.03
    Sequence makaqpieiaghefarkadalafmkvmlnryrpgdivstvdgaflvealkrhpdatskigpgvrnfevr sadygtqcfwilrtdgseerfsykkcv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k0m
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     
    2. Combining NMR ensembles and molecular dynamics simulations provides more realistic models of protein structures in solution and leads to better chemical shift
    J Lehtivarjo, K Tuppurainen, T Hassinen - Journal of Biomolecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch