.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k0z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of protein hp1203 from Helicobacter pylori 26695. Northeast Structural Genomics Consortium (NESG) target PT1/Ontario Center for Structural Proteomics target hp1203. To be Published
    Site NESGC
    PDB Id 2k0z Target Id PT1
    Molecular Characteristics
    Source Helicobacter pylori
    Alias Ids TPS8998,15661, 3.40.250.10, PF00581, 3.90.190.10 Molecular Weight 12930.84 Da.
    Residues 110 Isoelectric Point 4.70
    Sequence mledyaisleevnfndfivvdvreldeyeelhlpnatlisvndqekladflsqhkdkkvllhcragrra ldaaksmhelgytpyylegnvydfekygfrmvyddtcdkkn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch