.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k1h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of SeR13. To be Published
    Site NESGC
    PDB Id 2k1h Target Id SeR13
    Molecular Characteristics
    Source Staphylococcus epidermidis
    Alias Ids TPS9123,PF08712, 15678, 3.30.1370.70 Molecular Weight 9824.36 Da.
    Residues 86 Isoelectric Point 4.35
    Sequence meiiaisetpnhntmkvslseprqdnssttytaaqegqpefinrlfeiegvksifyvldfisidkedna nwnellpqientfaksn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k1h
    1. Determination of the structures of symmetric protein oligomers from NMR chemical shifts and residual dipolar couplings
    NG Sgourakis, OF Lange, F DiMaio - Journal of the , 2011 - ACS Publications
     
    2. Iron_ Sulfur Cluster Biosynthesis: Functional Characterization of the N-and C-Terminal Domains of Human NFU
    Y Liu, W Qi, JA Cowan - Biochemistry, 2009 - ACS Publications
     
    3. Three_dimensional structure of the weakly associated protein homodimer SeR13 using RDCs and paramagnetic surface mapping
    HW Lee, G Wylie, S Bansal, X Wang, AW Barb - Protein , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch