.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k1s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the folded C-terminal fragment of YiaD from Escherichia coli. Northeast Structural Genomics Consortium target ER553. To be Published
    Site NESGC
    PDB Id 2k1s Target Id ER553
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8858,3.30.1330.60, 15683, PF00691 Molecular Weight 20180.54 Da.
    Residues 199 Isoelectric Point 9.60
    Sequence mttnpytgereagksaigaglgslvgagigalssskkdrgkgaligaaagaalgggvgyymdvqeanvr dkmrgtgvsvtrsgdniilnmpnnvtfdsssatlkpagantltgvamvlkeypktavnvigytdstggh dlnmrlsqqradsvasalitqgvdasrirtqglgpanpiasnstaegkaqnrrveitlspl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k1s
    1. A modular BAM complex in the outer membrane of the _-proteobacterium Caulobacter crescentus
    K Anwari, S Poggio, A Perry, X Gatsos - PloS one, 2010 - dx.plos.org
     
    2. Structural biology of type VI secretion systems
    E Cascales, C Cambillau - of the Royal , 2012 - rstb.royalsocietypublishing.org
     
    3. A 35 kDa antigenic protein from Shigella flexneri: in silico structural and functional studies
    RL Yung-Hung, A Ismail, TS Lim, YS Choong - and Biophysical Research , 2011 - Elsevier
     
    4. Order and disorder in proteins
    A Ertekin - 2011 - mss3.libraries.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch