.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k2d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecular basis of Pirh2-mediated p53 ubiquitylation. Nat.Struct.Mol.Biol. 15 1334-1342 2008
    Site NESGC
    PDB Id 2k2d Target Id HT2C
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8929,15701, 2.20.28.10 Molecular Weight 8615.31 Da.
    Residues 75 Isoelectric Point 5.47
    Sequence mhsaldmtrywrqlddevaqtpmpseyqnmtvdilcndcngrstvqfhilgmkckicesyntaqaggrr isldqq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2k2d
    1. Molecular basis of Pirh2-mediated p53 ubiquitylation
    Y Sheng, RC Laister, A Lemak, B Wu, E Tai - Nature structural & , 2008 - nature.com
     
    2. CASP9 target classification
    LN Kinch, S Shi, H Cheng, Q Cong, J Pei - Proteins: Structure, , 2011 - Wiley Online Library
     
    3. Structure-oriented methods for protein NMR data analysis
    GA Bermejo, M Llins - Progress in nuclear magnetic resonance , 2010 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch