.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k2p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein Atu1203 from Agrobacterium tumefaciens. To be Published
    Site NESGC
    PDB Id 2k2p Target Id AtT10
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8740,3.30.70.100, PF00403 Molecular Weight 8472.99 Da.
    Residues 84 Isoelectric Point 5.68
    Sequence mctahqhhaetttapdnaglsfhvedmtcghcagvikgaiektvpgaavhadpasrtvvvggvsdaahi aeiitaagytpeara
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k2p
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch