.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k3a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural elucidation of the Cys-His-Glu-Asn proteolytic relay in the secreted CHAP domain enzyme from the human pathogen Staphylococcus saprophyticus. Proteins 74 515-519 2008
    Site NESGC
    PDB Id 2k3a Target Id SyR11
    Molecular Characteristics
    Source Staphylococcus saprophyticus
    Alias Ids TPS9183,PF05257, 15335 Molecular Weight 15915.19 Da.
    Residues 155 Isoelectric Point 4.47
    Sequence mkklvtattltagigaaivgldhgneadaaeqtqptnqsttqstsgssanlytagqctwyvydkvggni gstwgnannwasaassagytvnnspeagsilqstaggyghvayvenvnsdgsvevsemnynggpfsvse rtisageassynyihln
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k3a
    1. Structural Basis of Murein Peptide Specificity of a [gamma]-D-Glutamyl-L-Diamino Acid Endopeptidase
    Q Xu, S Sudek, D McMullan, MD Miller, B Geierstanger - Structure, 2009 - Elsevier
     
    2. Crystal structure of the anti-viral APOBEC3G catalytic domain and functional implications
    LG Holden, C Prochnow, YP Chang, R Bransteitter - Nature, 2008 - nature.com
     
    3. An extended structure of the APOBEC3G catalytic domain suggests a unique holoenzyme model
    E Harjes, PJ Gross, KM Chen, Y Lu, K Shindo - Journal of molecular , 2009 - Elsevier
     
    4. Crystal structure of the APOBEC3G catalytic domain reveals potential oligomerization interfaces
    S Shandilya, MNL Nalam, EA Nalivaika, PJ Gross - Structure, 2010 - Elsevier
     
    5. Solution NMR Structure of the NlpC/P60 Domain of Lipoprotein Spr from Escherichia coli: Structural Evidence for a Novel Cysteine Peptidase Catalytic Triad
    JM Aramini, P Rossi, YJ Huang, L Zhao, M Jiang - Biochemistry, 2008 - ACS Publications
     
    6. A microscale protein NMR sample screening pipeline
    P Rossi, GVT Swapna, YJ Huang, JM Aramini - Journal of biomolecular , 2010 - Springer
     
    7. Rationalisation of the differences between APOBEC3G structures from crystallography and NMR studies by molecular dynamics simulations
    F Autore, JRC Bergeron, MH Malim, F Fraternali - PloS one, 2010 - dx.plos.org
     
    8. Systematic analysis of an amidase domain CHAP in 12 Staphylococcus aureus genomes and 44 staphylococcal phage genomes
    Y Zou, C Hou - Computational biology and chemistry, 2010 - Elsevier
     
    9. Structural elucidation of the Cys_His_Glu_Asn proteolytic relay in the secreted CHAP domain enzyme from the human pathogen Staphylococcus saprophyticus
    P Rossi, JM Aramini, R Xiao, CX Chen - Proteins: Structure, , 2009 - Wiley Online Library
     
    10. In silico modelling of the staphylococcal bacteriophage-derived peptidase CHAPK
    M Fenton, JC Cooney, RP Ross, RD Sleator - , 2011 - landesbioscience.com
     
    11. Structural studies of the deaminase domain of the human HIV-1 restriction protein APOBEC3G
    KM Chen - 2010 - conservancy.umn.edu
     
    12. Crystal structure of the catalytic domain of the viral restriction factor APOBEC3G
    L Holden, C Prochnow, YP Chang - US Patent App. 12/ , 2009 - Google Patents
     
    13. ProteinWater Interactions in MD Simulations: POPS/POPSCOMP Solvent Accessibility Analysis, Solvation Forces and Hydration Sites
    A Fornili, N Chakroun, P Martinez - Methods in molecular , 2012 - Springer
     
    14. X-ray crystal structure of the streptococcal specific phage lysin PlyC
    S McGowan, AM Buckle, MS Mitchell - Proceedings of the , 2012 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch