.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k3d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the folded 79 residue fragment of Lin0334 from Listeria innocua. Northeast Structural Genomics Consortium target LkR15. To be Published
    Site NESGC
    PDB Id 2k3d Target Id LkR15
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS8949,PF07252, 3.10.450.130, 15750 Molecular Weight 15074.11 Da.
    Residues 128 Isoelectric Point 4.79
    Sequence mqhqeqekkdqaffneqkekvtlylkhnipdfntvtftneefnpigisidgyinndknlsftagkdvki fssseeldkmfqeprkgydeiiekeetslempkektktideilselksyedqvitrnki
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k3d
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     
    2. Order and disorder in proteins
    A Ertekin - 2011 - mss3.libraries.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch